PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PSME_00036966-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga
Family ZF-HD
Protein Properties Length: 168aa    MW: 18195.9 Da    PI: 7.1596
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PSME_00036966-RAgenomePRSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer993.4e-31102157359
       ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                        v Y eC+kNhAas+Gg+avDGCgEfm+s geegtaaalkCaAC+CHR FHRre e+
  PSME_00036966-RA 102 DVWYGECQKNHAASIGGYAVDGCGEFMAS-GEEGTAAALKCAACNCHRRFHRREFEN 157
                       689*************************9.999********************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-21101164IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.3E-29103155IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.0E-27105154IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.505105154IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MGRSAGFSLG GSYASHHHQQ QQQEIRSGLP TNGAGGSFVA IANSVDLMHL HGTDLFPYTH  60
GQASYHSQIQ DQSVGSVQKM RPSDVHHTEA TRRGADASFR KDVWYGECQK NHAASIGGYA  120
VDGCGEFMAS GEEGTAAALK CAACNCHRRF HRREFENGTL CECHDTGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1010402e-92BT101040.1 Picea glauca clone GQ0065_E22 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306048.13e-30zinc finger family protein
TrEMBLA9NYD82e-39A9NYD8_PICSI; Putative uncharacterized protein
STRINGPOPTR_0004s12510.11e-29(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.12e-29mini zinc finger 2